Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHLA class II histocompatibility antigen DRB1-1
LigandBDBM50326698
Substrate/Competitorn/a
Meas. Tech.ChEMBL_661466
IC50 11.5±n/a nM
Citation Venkatraman PNguyen TTSainlos MBilsel OChitta SImperiali BStern LJ Fluorogenic probes for monitoring peptide binding to class II MHC proteins in living cells. Nat Chem Biol 3:222-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HLA class II histocompatibility antigen DRB1-1
Name:Human leukocyte antigen DR beta chain
Synonyms:DR-1 | DR1 | HLA class II histocompatibility antigen, DRB1-1 beta chain | MHC class I antigen DRB1*1
Type:PROTEIN
Mol. Mass.:29917.79
Organism:Homo sapiens (Human)
Description:ChEMBL_192854
Residue:266
Sequence:
MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCI
YNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326698
n/a
NameBDBM50326698
Synonyms:(6S,9S,12S,15S,18S,21S,24S,27S)-1-amino-6-((S)-2-amino-3-(6-(dimethylamino)-1,3-dioxo-1H-benzo[f]isoindol-2(3H)-yl)propanamido)-9-(hydroxymethyl)-1-imino-15,18,21,24,29-pentamethyl-12-(2-(methylthio)ethyl)-7,10,13,16,19,22,25-heptaoxo-2,8,11,14,17,20,23,26-octaazatriacontane-27-carboxylic acid | CHEMBL1253323
TypeSmall organic molecule
Emp. Form.C49H74N14O13S
Mol. Mass.1099.263
SMILES[#6]-[#16]-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#8])-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-[#7]-1-[#6](=O)-c2cc3ccc(cc3cc2-[#6]-1=O)-[#7](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#6])-[#6])-[#6](-[#8])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: