Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50156455
Substrate/Competitorn/a
Meas. Tech.ChEMBL_662793
IC50 0.26±n/a nM
Citation Huang HPlayer MR Bradykinin B1 receptor antagonists as potential therapeutic agents for pain. J Med Chem 53:5383-99 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39519.62
Organism:Oryctolagus cuniculus
Description:ChEMBL_796432
Residue:352
Sequence:
MASQGPLELQPSNQSQLAPPNATSCSGAPDAWDLLHRLLPTFIIAIFTLGLLGNSFVLSV
FLLARRRLSVAEIYLANLAASDLVFVLGLPFWAENVRNQFDWPFGAALCRIVNGVIKANL
FISIFLVVAISQDRYSVLVHPMASRRGRRRRQAQATCALIWLAGGLLSTPTFVLRSVRAV
PELNVSACILLLPHEAWHWLRMVELNLLGFLLPLAAILFFNCHILASLRRRGERVPSRCG
GPRDSKSTALILTLVASFLVCWAPYHFFAFLECLWQVHAIGGCFWEEFTDLGLQLSNFSA
FVNSCLNPVIYVFVGRLFRTKVWELCQQCSPRSLAPVSSSRRKEMLWGFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156455
n/a
NameBDBM50156455
Synonyms:(R)-N-(4-(4,5-dihydro-1H-imidazol-2-yl)phenethyl)-2-(1-(3,4-dichlorophenylsulfonyl)-3-oxo-1,2,3,4-tetrahydroquinoxalin-2-yl)acetamide | 2-[(R)-1-(3,4-Dichloro-benzenesulfonyl)-3-oxo-1,2,3,4-tetrahydro-quinoxalin-2-yl]-N-{2-[4-(4,5-dihydro-1H-imidazol-2-yl)-phenyl]-ethyl}-acetamide | CHEMBL189123
TypeSmall organic molecule
Emp. Form.C27H25Cl2N5O4S
Mol. Mass.586.49
SMILESClc1ccc(cc1Cl)S(=O)(=O)N1[C@H](CC(=O)NCCc2ccc(cc2)C2=NCCN2)C(=O)Nc2ccccc12 |r,t:27|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: