Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAVPR1A
LigandBDBM50064711
Substrate/Competitorn/a
Meas. Tech.ChEMBL_661539
Ki 0.76±n/a nM
Citation Borthwick AD Oral oxytocin antagonists. J Med Chem 53:6525-38 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AVPR1A
Name:Vasopressin receptor
Synonyms:VASOPRESSIN V1A | Vasopressin V1 receptor | Vasopressin V1a receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:47674.81
Organism:RAT
Description:VASOPRESSIN V1A AVPR1A RAT::P30560
Residue:424
Sequence:
MSFPRGSQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAKLEIAVLAV
IFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGP
DWLCRVVKHLQVFAMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIATSWVLSFI
LSTPQYFIFSVIEIEVNNGTKTQDCWATFIQPWGTRAYVTWMTSGVFVAPVVVLGTCYGF
ICYHIWRNIRGKTASSRHSKGDKGSGEAVGPFHKGLLVTPCVSSVKSISRAKIRTVKMTF
VIVSAYILCWAPFFIVQMWSVWDENFIWTDSENPSITITALLASLNSCCNPWIYMFFSGH
LLQDCVQSFPCCHSMAQKFAKDDSDSMSRRQTSYSNNRSPTNSTGMWKDSPKSSKSIRFI
PVST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064711
n/a
NameBDBM50064711
Synonyms:1-(1-{2-Methoxy-4-[1-(2-methyl-1-oxy-pyridin-3-ylmethyl)-piperidin-4-yloxy]-benzoyl}-piperidin-4-yl)-1,4-dihydro-benzo[d][1,3]oxazin-2-one | CHEMBL306645
TypeSmall organic molecule
Emp. Form.C33H38N4O6
Mol. Mass.586.678
SMILESCOc1cc(OC2CCN(Cc3ccc[n+]([O-])c3C)CC2)ccc1C(=O)N1CCC(CC1)N1C(=O)OCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: