| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytochrome c oxidase subunit 2 |
|---|
| Ligand | BDBM50300870 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_662815 (CHEMBL1252215) |
|---|
| IC50 | 91±n/a nM |
|---|
| Citation |  Zarghi, A; Ghodsi, R Design, synthesis, and biological evaluation of ketoprofen analogs as potent cyclooxygenase-2 inhibitors. Bioorg Med Chem18:5855-60 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytochrome c oxidase subunit 2 |
|---|
| Name: | Cytochrome c oxidase subunit 2 |
|---|
| Synonyms: | COII | COX2 | COX2_SHEEP | COXII | Cytochrome c oxidase polypeptide II | MT-CO2 | MTCO2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25987.16 |
|---|
| Organism: | Ovis aries |
|---|
| Description: | ChEMBL_662815 |
|---|
| Residue: | 227 |
|---|
| Sequence: | MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILIMIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLPSWAVPSLGLKTDAIPGRLN
QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
|
|
|
|---|
| BDBM50300870 |
|---|
| n/a |
|---|
| Name | BDBM50300870 |
|---|
| Synonyms: | 2-(4-(methylsulfonyl)phenyl)-quinoline-4-carboxylic acid | CHEMBL579203 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13NO4S |
|---|
| Mol. Mass. | 327.354 |
|---|
| SMILES | CS(=O)(=O)c1ccc(cc1)-c1cc(C(O)=O)c2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
