Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpithelial discoidin domain-containing receptor 1
LigandBDBM13530
Substrate/Competitorn/a
Meas. Tech.ChEMBL_663681
IC50 43±n/a nM
Citation Manley PWStiefl NCowan-Jacob SWKaufman SMestan JWartmann MWiesmann MWoodman RGallagher N Structural resemblances and comparisons of the relative pharmacological properties of imatinib and nilotinib. Bioorg Med Chem 18:6977-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epithelial discoidin domain-containing receptor 1
Name:Epithelial discoidin domain-containing receptor 1
Synonyms:Discoidin domain receptor 1 (DDR1) | Discoidin domain-containing receptor 1 (DDR1) | Discoidin receptor tyrosine kinase | Epithelial discoidin domain receptor 1 | Epithelial discoidin domain receptor 1 (DDR1) | HGK2 | Mammary carcinoma kinase 10 | Protein-tyrosine kinase RTK 6 | Tyrosine-protein kinase CAK
Type:Tyrosine-protein kinase
Mol. Mass.:101130.02
Organism:Homo sapiens (Human)
Description:Q08345
Residue:913
Sequence:
MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRL
RYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWRDGLLSYTAPVGQTMYLSEAVYLNDSTYDGHTVGGLQYGGLGQLADGVVGLDD
FRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGG
VECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFS
EISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI
GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPRE
PPPYQEPRPRGNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNT
QAYSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGP
PRVDFPRSRLRFKEKLGEGQFGEVHLCEVDSPQDLVSLDFPLNVRKGHPLLVAVKILRPD
ATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQLED
KAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTI
KIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC
RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQ
LHRFLAEDALNTV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13530
n/a
NameBDBM13530
Synonyms:4-[(4-methylpiperazin-1-yl)methyl]-N-[4-methyl-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]phenyl]benzamide | CHEMBL941 | Gleevec | IMATINIB | Imatinib | Imatinib, 21 | N-(4-methyl-3-{[4-(pyridin-3-yl)pyrimidin-2-yl]amino}phenyl)-4-[(4-methylpiperazin-1-yl)methyl]benzamide | STI-571 | STI571 | US9255107, Imatinib | cid_5291 | imatinib-CD3
TypeSmall organic molecule
Emp. Form.C29H31N7O
Mol. Mass.493.6027
SMILESCN1CCN(Cc2ccc(cc2)C(=O)Nc2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: