Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiscoidin domain-containing receptor 2
LigandBDBM50237710
Substrate/Competitorn/a
Meas. Tech.ChEMBL_663680
IC50 5.2±n/a nM
Citation Manley PWStiefl NCowan-Jacob SWKaufman SMestan JWartmann MWiesmann MWoodman RGallagher N Structural resemblances and comparisons of the relative pharmacological properties of imatinib and nilotinib. Bioorg Med Chem 18:6977-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Discoidin domain-containing receptor 2
Name:Discoidin domain-containing receptor 2
Synonyms:Discoidin domain receptor 2 (DDR2) | Discoidin domain-containing receptor 2 (DDR2) | Epithelial discoidin domain-containing receptor 2 (DDR2)
Type:Protein
Mol. Mass.:96717.07
Organism:Homo sapiens (Human)
Description:n/a
Residue:855
Sequence:
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50237710
n/a
NameBDBM50237710
Synonyms:4-methyl-N-[3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl]-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]benzamide | AMN 107 | AMN107 | CHEMBL255863 | NILOTINIB
TypeSmall organic molecule
Emp. Form.C28H22F3N7O
Mol. Mass.529.5158
SMILESCc1cn(cn1)-c1cc(NC(=O)c2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)cc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: