| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM21679 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_664648 (CHEMBL1260362) |
|---|
| IC50 | 140±n/a nM |
|---|
| Citation |  Herbert, MR; Siegel, DL; Staszewski, L; Cayanan, C; Banerjee, U; Dhamija, S; Anderson, J; Fan, A; Wang, L; Rix, P; Shiau, AK; Rao, TS; Noble, SA; Heyman, RA; Bischoff, E; Guha, M; Kabakibi, A; Pinkerton, AB Synthesis and SAR of 2-aryl-3-aminomethylquinolines as agonists of the bile acid receptor TGR5. Bioorg Med Chem Lett20:5718-21 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 35260.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | CHO cells transiently transfected with hTGR5. |
|---|
| Residue: | 330 |
|---|
| Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
|---|
| BDBM21679 |
|---|
| n/a |
|---|
| Name | BDBM21679 |
|---|
| Synonyms: | (2S,4R)-4-[(1S,2S,5R,7S,8R,9R,10S,11S,14R,15R)-8-ethyl-5,9-dihydroxy-2,15-dimethyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadecan-14-yl]-2-methylpentanoic acid | 23(S)-methyl-BA derivative, 7c |
|---|
| Type | Steroid |
|---|
| Emp. Form. | C27H46O4 |
|---|
| Mol. Mass. | 434.6517 |
|---|
| SMILES | [H][C@@]1(CC[C@@]2([H])[C@]3([H])[C@H](O)[C@H](CC)[C@]4([H])C[C@H](O)CC[C@]4(C)[C@@]3([H])CC[C@]12C)[C@H](C)C[C@H](C)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
