Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM50327861
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664907
Ki 0.738000±n/a nM
Citation Xu RHong JMorse CLPike VW Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. J Med Chem 53:7035-47 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR4
Name:Serotonin 4 (5-HT4) receptor
Synonyms:5-HT4 | 5-hydroxytryptamine receptor 4 | Serotonin 4 (5-HT4) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43735.29
Organism:GUINEA PIG
Description:5-HT4 HTR4 GUINEA PIG::O70528
Residue:388
Sequence:
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRP
QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
TVECGGQWESQCHPAASSPLVAAQPIDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327861
n/a
NameBDBM50327861
Synonyms:(1-Butylpiperidin-4-yl)methyl 4-Amino-3-methoxybenzoate | CHEMBL1258452
TypeSmall organic molecule
Emp. Form.C18H28N2O3
Mol. Mass.320.4265
SMILESCCCCN1CCC(COC(=O)c2ccc(N)c(OC)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: