Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 4 (5-HT4)
LigandBDBM50327873
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664908
Ki 8664±n/a nM
Citation Xu RHong JMorse CLPike VW Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. J Med Chem 53:7035-47 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 4 (5-HT4)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4
Type:Enzyme
Mol. Mass.:43767.54
Organism:Homo sapiens (Human)
Description:Q13639
Residue:388
Sequence:
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327873
n/a
NameBDBM50327873
Synonyms:4-Amino-N-((1-butylpiperidin-4-yl)methyl)-3-methoxybenzamide | CHEMBL1258559
TypeSmall organic molecule
Emp. Form.C18H29N3O2
Mol. Mass.319.4418
SMILESCCCCN1CCC(CNC(=O)c2ccc(N)c(OC)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: