Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50327860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664956
Ki 2727±n/a nM
Citation Xu RHong JMorse CLPike VW Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. J Med Chem 53:7035-47 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55641.53
Organism:Cavia porcellus (domestic guinea pig)
Description:Guinea pig cerebellum was used in binding assay.
Residue:488
Sequence:
MSFLPGMTPVTLSNFSWALEDRMLEGNSTTTPTRQLMPLVVVLSSVSLVTVALNLLVLYA
VRSERKLHTVGNLYIVSLSVADLIVGAVVMPMSILYLHRSAWILGRPLCLFWLSMDYVAS
TASIFSVFILCIDRYRSVQQPLRYLRYRTKTRASATILGAWLLSFLWVIPILGWHHFMAP
TSEPREKKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYIRIYKAVRRHCQHRQLINSSL
PSFSEMKLKLENAKVDTRRMGKESPWEDPKRCSKDASGVHTPMPSSQHLVDMPCAAVLSE
DEGGEVGTRQMPMLAVGDGRCCEALNHMHSQLELSGQSRATHSISARPEEWTVVDGQSFP
ITDSDTSTEAAPMGGQPRSGSNSGLDYIKFTWRRLRSHSRQYTSGLHLNRERKAAKQLGC
IMAAFILCWIPYFVFFMVIAFCKSCSNEPVHMFTIWLGYLNSTLNPLIYPLCNENFRKTF
KRILRIPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327860
n/a
NameBDBM50327860
Synonyms:(1-Butylpiperidin-4-yl)methyl 7-chloro-8-(methylamino)-2,3-dihydrobenzo[b][1,4]dioxine-5-carboxylate | CHEMBL1258223
TypeSmall organic molecule
Emp. Form.C20H29ClN2O4
Mol. Mass.396.908
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(NC)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: