Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2C
LigandBDBM50327860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664930
Ki 685±n/a nM
Citation Xu RHong JMorse CLPike VW Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. J Med Chem 53:7035-47 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2C
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51836.79
Organism:Homo sapiens (Human)
Description:P28335
Residue:458
Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327860
n/a
NameBDBM50327860
Synonyms:(1-Butylpiperidin-4-yl)methyl 7-chloro-8-(methylamino)-2,3-dihydrobenzo[b][1,4]dioxine-5-carboxylate | CHEMBL1258223
TypeSmall organic molecule
Emp. Form.C20H29ClN2O4
Mol. Mass.396.908
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(NC)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: