Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1D
LigandBDBM50327863
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664926
Ki 2856±n/a nM
Citation Xu RHong JMorse CLPike VW Synthesis, structure-affinity relationships, and radiolabeling of selective high-affinity 5-HT4 receptor ligands as prospective imaging probes for positron emission tomography. J Med Chem 53:7035-47 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1D
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | Serotonin Receptor 1D
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41920.63
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells.
Residue:377
Sequence:
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327863
n/a
NameBDBM50327863
Synonyms:(1-Butylpiperidin-4-yl)methyl 8-Amino-7-fluoro-2,3-dihydrobenzo[b][1,4]dioxine-5-carboxylate | CHEMBL1258671
TypeSmall organic molecule
Emp. Form.C19H27FN2O4
Mol. Mass.366.4271
SMILESCCCCN1CCC(COC(=O)c2cc(F)c(N)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: