Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT2
LigandBDBM50328444
Substrate/Competitorn/a
Meas. Tech.ChEMBL_665580
Ki 110±n/a nM
Citation Skultety MHübner HLöber SGmeiner P Bioisosteric replacement leading to biologically active [2.2]paracyclophanes with altered binding profiles for aminergic G-protein-coupled receptors. J Med Chem 53:7219-28 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-HT2
Name:Serotonin 2a (5-HT2a) receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A
Type:Enzyme Catalytic Domain
Mol. Mass.:52679.13
Organism:PIG
Description:5-HT2 0 0::P50129
Residue:470
Sequence:
MDVLCEENTSLSSPTNSFMQLNDDTRLYHNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHRRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGAL
LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS
SQLQTGQKENSKQDDKATENDCTMVALGKQHSEDAPADNSNTVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328444
n/a
NameBDBM50328444
Synonyms:4-[4-(2,5-Dimethylphenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL1257689
TypeSmall organic molecule
Emp. Form.C23H28FNO2
Mol. Mass.369.4723
SMILESCc1ccc(C)c(c1)C1(O)CCN(CCCC(=O)c2ccc(F)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: