Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetheat shock 70kDa protein 8 isoform 1
LigandBDBM31995
Substrate/Competitorn/a
Meas. Tech.ChEMBL_675336
Kd 260±n/a nM
Citation Massey AJ ATPases as drug targets: insights from heat shock proteins 70 and 90. J Med Chem 53:7280-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
heat shock 70kDa protein 8 isoform 1
Name:heat shock 70kDa protein 8 isoform 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:70887.67
Organism:Homo sapiens (Human)
Description:gi_5729877
Residue:646
Sequence:
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31995
n/a
NameBDBM31995
Synonyms:ADP | Adenosine Diphosphate (ADP) | CHEMBL14830
TypeNucleoside or nucleotide
Emp. Form.C10H15N5O10P2
Mol. Mass.427.2011
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: