Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine N-methyltransferase 1
LigandBDBM50206427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_675342
IC50 137100±n/a nM
Citation Feng YLi MWang BZheng YG Discovery and mechanistic study of a class of protein arginine methylation inhibitors. J Med Chem 53:6028-39 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine N-methyltransferase 1
Name:Protein-arginine N-methyltransferase 1
Synonyms:Protein arginine N-methyltransferase 1 (PRMT1) | Protein arginine methyltransferase 1 (PRMT1)
Type:Protein
Mol. Mass.:41506.52
Organism:Homo sapiens (Human)
Description:n/a
Residue:361
Sequence:
MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIV
KANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGL
IFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNAC
LIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYT
HWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRM
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206427
n/a
NameBDBM50206427
Synonyms:7,7'-carbonylbis(azanediyl)bis(4-hydroxynaphthalene-2-sulfonic acid) | AMI-1 | CHEMBL221047
TypeSmall organic molecule
Emp. Form.C21H16N2O9S2
Mol. Mass.504.49
SMILESOc1cc(cc2cc(NC(=O)Nc3ccc4c(O)cc(cc4c3)S(O)(=O)=O)ccc12)S(O)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: