| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 13 |
|---|
| Ligand | BDBM24514 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_673817 (CHEMBL1274994) |
|---|
| IC50 | 1050±n/a nM |
|---|
| Citation |  Innocenti, A; Supuran, CT Paraoxon, 4-nitrophenyl phosphate and acetate are substrates ofa- but not ofß-,¿- and¿-carbonic anhydrases. Bioorg Med Chem Lett20:6208-12 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 13 |
|---|
| Name: | Carbonic anhydrase 13 |
|---|
| Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29522.80 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Murine cloned isozyme |
|---|
| Residue: | 262 |
|---|
| Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
|---|
| BDBM24514 |
|---|
| n/a |
|---|
| Name | BDBM24514 |
|---|
| Synonyms: | 4-nitrophenoxyphosphonic acid | 4-nitrophenyl phosphate | CHEMBL24231 | p-nitrophenyl phosphate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H6NO6P |
|---|
| Mol. Mass. | 219.0887 |
|---|
| SMILES | OP(O)(=O)Oc1ccc(cc1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
