Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50329135
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674397
Ki 1.4±n/a nM
Citation Tong LShankar BBChen LRizvi RKelly JGilbert EHuang CYang DYKozlowski JAShih NYGonsiorek WHipkin RWMalikzay ALunn CALundell DJ Expansion of SAR studies on triaryl bis sulfone cannabinoid CB2 receptor ligands. Bioorg Med Chem Lett 20:6785-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329135
n/a
NameBDBM50329135
Synonyms:1,1,1-trifluoro-N-((1-(2-(2-fluorophenylsulfonyl)furan-3-ylsulfonyl)piperidin-4-yl)methyl)methanesulfonamide | CHEMBL1270681
TypeSmall organic molecule
Emp. Form.C17H18F4N2O7S3
Mol. Mass.534.523
SMILESFc1ccccc1S(=O)(=O)c1occc1S(=O)(=O)N1CCC(CNS(=O)(=O)C(F)(F)F)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: