Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase BRK
LigandBDBM50329427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_673936
IC50>1±n/a nM
Citation Menichincheri MAlbanese CAlli CBallinari DBargiotti ACaldarelli MCiavolella ACirla AColombo MColotta FCroci VD'Alessio RD'Anello MErmoli AFiorentini FForte BGalvani AGiordano PIsacchi AMartina KMolinari AMoll JKMontagnoli AOrsini POrzi FPesenti EPillan ARoletto FScolaro ATatò MTibolla MValsasina BVarasi MVianello PVolpi DSantocanale CVanotti E Cdc7 kinase inhibitors: 5-heteroaryl-3-carboxamido-2-aryl pyrroles as potential antitumor agents. 1. Lead finding. J Med Chem 53:7296-315 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase BRK
Name:Tyrosine-protein kinase BRK
Synonyms:Breast tumor kinase | KH domain-containing, RNA-binding, signal transduction-associated protein 1 | Protein-tyrosine kinase 6 (BRK) | Tyrosine Kinase BRK | Tyrosine-protein kinase 6
Type:Tyrosine-protein kinase
Mol. Mass.:51839.11
Organism:Homo sapiens (Human)
Description:n/a
Residue:451
Sequence:
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329427
n/a
NameBDBM50329427
Synonyms:5-(2-Amino-pyrimidin-4-yl)-2-phenyl-1H-pyrrole-3-carboxamide | CHEMBL1270230 | US9670191, U1
TypeSmall organic molecule
Emp. Form.C15H13N5O
Mol. Mass.279.2966
SMILESNC(=O)c1cc([nH]c1-c1ccccc1)-c1ccnc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: