Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCell division cycle 7-related protein kinase
LigandBDBM50329437
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674074
IC50>1±n/a nM
Citation Menichincheri MAlbanese CAlli CBallinari DBargiotti ACaldarelli MCiavolella ACirla AColombo MColotta FCroci VD'Alessio RD'Anello MErmoli AFiorentini FForte BGalvani AGiordano PIsacchi AMartina KMolinari AMoll JKMontagnoli AOrsini POrzi FPesenti EPillan ARoletto FScolaro ATatò MTibolla MValsasina BVarasi MVianello PVolpi DSantocanale CVanotti E Cdc7 kinase inhibitors: 5-heteroaryl-3-carboxamido-2-aryl pyrroles as potential antitumor agents. 1. Lead finding. J Med Chem 53:7296-315 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cell division cycle 7-related protein kinase
Name:Cell division cycle 7-related protein kinase
Synonyms:Cell division cycle 7-related protein kinase | Cell division cycle 7-related protein kinase (CDC7)
Type:Protein
Mol. Mass.:63908.16
Organism:Homo sapiens (Human)
Description:O00311
Residue:574
Sequence:
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329437
n/a
NameBDBM50329437
Synonyms:5-(2-Amino-pyrimidin-4-yl)-2-phenyl-1H-pyrrole-3-carboxylicAcid Methylamide | CHEMBL1270717 | US9670191, M1
TypeSmall organic molecule
Emp. Form.C16H15N5O
Mol. Mass.293.3232
SMILESCNC(=O)c1cc([nH]c1-c1ccccc1)-c1ccnc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: