Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh affinity nerve growth factor receptor
LigandBDBM50329427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674086
IC50>1±n/a nM
Citation Menichincheri MAlbanese CAlli CBallinari DBargiotti ACaldarelli MCiavolella ACirla AColombo MColotta FCroci VD'Alessio RD'Anello MErmoli AFiorentini FForte BGalvani AGiordano PIsacchi AMartina KMolinari AMoll JKMontagnoli AOrsini POrzi FPesenti EPillan ARoletto FScolaro ATatò MTibolla MValsasina BVarasi MVianello PVolpi DSantocanale CVanotti E Cdc7 kinase inhibitors: 5-heteroaryl-3-carboxamido-2-aryl pyrroles as potential antitumor agents. 1. Lead finding. J Med Chem 53:7296-315 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
High affinity nerve growth factor receptor
Name:High affinity nerve growth factor receptor
Synonyms:2.7.10.1 | MTC | NTRK1 | Nerve growth factor receptor Trk-A | Neurotrophic tyrosine kinase receptor type 1 | Neurotrophic tyrosine kinase receptor type 1 (TrkA) | Synonyms=MTC | TRK | TRK1-transforming tyrosine kinase protein | TRKA | Trk-A | Tropomyosin alpha-3 chain/High affinity nerve growth factor receptor | Tropomyosin-related kinase A | Tropomyosin-related kinase A (TrkA) | Tyrosine kinase receptor | Tyrosine kinase receptor (Trk) | Tyrosine kinase receptor A | Tyrosine kinase receptor A (Trk A) | Tyrosine kinase receptor A (Trk-A) | Tyrosine kinase receptor A (TrkA) | gp140trk | p140-TrkA
Type:n/a
Mol. Mass.:87498.18
Organism:Homo sapiens (Human)
Description:P04629
Residue:796
Sequence:
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329427
n/a
NameBDBM50329427
Synonyms:5-(2-Amino-pyrimidin-4-yl)-2-phenyl-1H-pyrrole-3-carboxamide | CHEMBL1270230 | US9670191, U1
TypeSmall organic molecule
Emp. Form.C15H13N5O
Mol. Mass.279.2966
SMILESNC(=O)c1cc([nH]c1-c1ccccc1)-c1ccnc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: