Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProteinase-activated receptor 1
LigandBDBM50329618
Substrate/Competitorn/a
Meas. Tech.ChEMBL_675462
Ki 19±n/a nM
Citation Xia YChackalamannil SGreenlee WJWang YHu ZRoot YWong JKong JAhn HSBoykow GHsieh YKurowski SChintala M Discovery of a vorapaxar analog with increased aqueous solubility. Bioorg Med Chem Lett 20:6676-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proteinase-activated receptor 1
Name:Proteinase-activated receptor 1
Synonyms:Coagulation factor II receptor | PAR-1 | Proteinase activated receptor 1 | Proteinase-activated receptor 1 (PAR-1) | Thrombin receptor | Thrombin receptor/ Proteinase-activated receptor 1(Par-1)
Type:Protein
Mol. Mass.:47450.07
Organism:Homo sapiens (Human)
Description:P25116
Residue:425
Sequence:
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329618
n/a
NameBDBM50329618
Synonyms:CHEMBL1270738 | ethyl(1R,3aR,4aR,6R,8aR,9S,9aS)-9-((E)-2-(2,3'-bipyridin-6'-yl)vinyl)-1-methyl-3-oxododecahydronaphtho[2,3-c]furan-6-ylcarbamate
TypeSmall organic molecule
Emp. Form.C28H33N3O4
Mol. Mass.475.5793
SMILESCCOC(=O)N[C@@H]1CC[C@@H]2[C@H](C[C@@H]3[C@@H]([C@@H](C)OC3=O)[C@H]2C=Cc2ccc(cn2)-c2ccccn2)C1 |r,w:21.23|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: