Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 13 (CA XIII)
LigandBDBM50329759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674746
Kd 2±n/a nM
Citation Sudžius JBaranauskiene LGolovenko DMatuliene JMichailoviene VTorresan JJachno JSukackaite RManakova EGražulis STumkevičius SMatulis D 4-[N-(substituted 4-pyrimidinyl)amino]benzenesulfonamides as inhibitors of carbonic anhydrase isozymes I, II, VII, and XIII. Bioorg Med Chem 18:7413-21 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 13 (CA XIII)
Name:Carbonic anhydrase 13 (CA XIII)
Synonyms:Carbonic anhydrase XIII (CA XIII)
Type:Enzyme
Mol. Mass.:29445.78
Organism:Homo sapiens (Human)
Description:Q8N1Q1
Residue:262
Sequence:
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329759
n/a
NameBDBM50329759
Synonyms:4-[(6-chloro-5-nitropyrimidin-4-yl)amino]benzenesulfonamide | 4-[N-(6-Chloro-5-nitropyrimidin-4-yl)amino]benzenesulfonamide | CHEMBL1233722
TypeSmall organic molecule
Emp. Form.C10H8ClN5O4S
Mol. Mass.329.72
SMILESNS(=O)(=O)c1ccc(Nc2ncnc(Cl)c2[N+]([O-])=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: