Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-activated protein kinase 5
LigandBDBM50330261
Substrate/Competitorn/a
Meas. Tech.ChEMBL_676347
IC50>10000±n/a nM
Citation Cho YSBorland MBrain CChen CHCheng HChopra RChung KGroarke JHe GHou YKim SKovats SLu YO'Reilly MShen JSmith TTrakshel GVögtle MXu MXu MSung MJ 4-(Pyrazol-4-yl)-pyrimidines as selective inhibitors of cyclin-dependent kinase 4/6. J Med Chem 53:7938-57 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-activated protein kinase 5
Name:MAP kinase-activated protein kinase 5
Synonyms:MAP kinase-activated protein kinase 5 (PRAK) | MAPK-Activated Protein Kinase 5 (MK5) | MAPK-activated protein kinase 5 | MAPKAP kinase 5 | PRAK | p38-regulated/activated protein kinase | p38-regulated/activated protein kinase (PRAK)
Type:Serine/threonine-protein kinase
Mol. Mass.:54229.92
Organism:Homo sapiens (Human)
Description:Recombinant MAPKAPK5 was phosphorylated by incubation with active p38alpha before assays.
Residue:473
Sequence:
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330261
n/a
NameBDBM50330261
Synonyms:4-(5-Chloro-3-isopropyl-1H-pyrazol-4-yl)-N-(5-(4-(dimethylamino)piperidin-1-yl)pyridin-2-yl)pyrimidin-2-amine | CHEMBL1272116
TypeSmall organic molecule
Emp. Form.C22H29ClN8
Mol. Mass.440.972
SMILESCC(C)c1n[nH]c(Cl)c1-c1ccnc(Nc2ccc(cn2)N2CCC(CC2)N(C)C)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: