Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUridine phosphorylase (UPase)
LigandBDBM50078082
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684504
Ki 2300±n/a nM
Citation Cui HRuda GFCarrero-Lérida JRuiz-Pérez LMGilbert IHGonzález-Pacanowska D Exploring new inhibitors of Plasmodium falciparum purine nucleoside phosphorylase. Eur J Med Chem 45:5140-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Uridine phosphorylase (UPase)
Name:Uridine phosphorylase (UPase)
Synonyms:UPase 1 | UrdPase 1
Type:Enzyme
Mol. Mass.:33939.54
Organism:Homo sapiens (Human)
Description:Q16831
Residue:310
Sequence:
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50078082
n/a
NameBDBM50078082
Synonyms:5-(3-Benzyloxy-benzyl)-pyrimidine-2,4,6-trione | CHEMBL37519
TypeSmall organic molecule
Emp. Form.C18H16N2O4
Mol. Mass.324.3306
SMILESOc1[nH]c(=O)[nH]c(=O)c1Cc1cccc(OCc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: