Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurine Nucleoside Phosphorylase (PNP)
LigandBDBM50330394
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684503
Ki 27000±n/a nM
Citation Cui HRuda GFCarrero-Lérida JRuiz-Pérez LMGilbert IHGonzález-Pacanowska D Exploring new inhibitors of Plasmodium falciparum purine nucleoside phosphorylase. Eur J Med Chem 45:5140-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purine Nucleoside Phosphorylase (PNP)
Name:Purine Nucleoside Phosphorylase (PNP)
Synonyms:pfPNP
Type:Enzyme
Mol. Mass.:26857.85
Organism:Plasmodium falciparum
Description:n/a
Residue:245
Sequence:
MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVDLAYNREYKSVECHYKGQKFL
CVSHGVGSAGCAVCFEELCQNGAKVIIRAGSCGSLQPDLIKRGDICICNAAVREDRVSHL
LIHGDFPAVGDFDVYDTLNKCAQELNVPVFNGISVSSDMYYPNKIIPSRLEDYSKANAAV
VEMELATLMVIGTLRKVKTGGILIVDGCPFKWDEGDFDNNLVPHQLENMIKIALGACAKL
ATKYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330394
n/a
NameBDBM50330394
Synonyms:1-((2-Pyrrolidine-1-yl)-ethyl)uracil | CHEMBL1275699
TypeSmall organic molecule
Emp. Form.C10H15N3O2
Mol. Mass.209.245
SMILESO=c1ccn(CCN2CCCC2)c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: