Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransporter
LigandBDBM35229
Substrate/Competitorn/a
Meas. Tech.ChEMBL_685424
Ki 0.78±n/a nM
Citation Altenbach RJBlack LAStrakhova MIManelli AMCarr TLMarsh KCWetter JMWensink EJHsieh GCHonore PGarrison TRBrioni JDCowart MD Diaryldiamines with dual inhibition of the histamine H(3) receptor and the norepinephrine transporter and the efficacy of 4-(3-(methylamino)-1-phenylpropyl)-6-(2-(pyrrolidin-1-yl)ethoxy)naphthalen-1-ol in pain. J Med Chem 53:7869-73 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transporter
Name:Transporter
Synonyms:NET | Norepinephrine transporter(NET)
Type:Multi-pass membrane protein
Mol. Mass.:69236.90
Organism:Rattus norvegicus (rat)
Description:Q63380
Residue:617
Sequence:
MLLARMKPQVQPELGGADQLPEQPLRPCKTADLLVVKERNGVQCLLASQDGDAQPRETWG
KEIDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLIPYTLFLIIAGMPLFYMELALGQFN
REGAATVWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFASFTLNLPWTNCGHAW
NSPNCTDPKLLNASVLGDHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLC
LMVVIVVLYFSLWKGVKTSGKVVWITATLPYFVLFVLLVHGVTLPGASNGINAYLHIDFY
RLKEATVWIDAATQIFFSLGAGFGVLIAFASYNKFDNNCYRDALLTSTINCVTSFISGFA
IFSILGYMAHEHKVKIEDVATEGAGLVFVLYPEAISTLSGSTFWAVLFFLMLLALGLDSS
MGGMEAVITGLADDFQVLKRHRKLFTCAVTLGTFLLAMFCITKGGIYVLTLLDTFAAGTS
ILFAVLMEAIGVSWFYGVDRFSNDIQQMMGFKPGLYWRLCWKFVSPAFLLFVVVVSIINF
KPLTYDDYVYPPWANWVGWGIALSSMILVPAYVIYKFFSIRGSLWERVAYGITPENEHHL
VAQRDVRQFQLRHWLAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35229
n/a
NameBDBM35229
Synonyms:3-(10,11-dihydro-5H-dibenzo[b,f]azepin-5-yl)-N-methylpropan-1-amine | 5-(gamma-methylaminopropyl)iminodibenzyl | CHEMBL72 | DESIPRAMINE | DESIPRAMINE HYDROCHLORIDE | DMI | Desipramin | Desipramine | Desmethylimipramine | N-(3-methylaminopropyl)iminobibenzyl | demethylimipramine | monodemethylimipramine | norimipramine
TypeSmall organic molecule
Emp. Form.C18H22N2
Mol. Mass.266.3807
SMILESCNCCCN1c2ccccc2CCc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: