Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50331732
Substrate/Competitorn/a
Meas. Tech.ChEMBL_687945
Ki 0.38±n/a nM
Citation Li LBeaulieu CCarriere MCDenis DGreig GGuay DO'Neill GZamboni RWang Z Potent and highly selective DP1 antagonists with 2,3,4,9-tetrahydro-1H-carbazole as pharmacophore. Bioorg Med Chem Lett 20:7462-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme
Mol. Mass.:40288.87
Organism:Homo sapiens (Human)
Description:Q13258
Residue:359
Sequence:
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50331732
n/a
NameBDBM50331732
Synonyms:2-((R)-9-((S)-1-(4-chloro-3-fluorophenyl)ethyl)-6-fluoro-8-(methylsulfonyl)-2,3,4,9-tetrahydro-1H-carbazol-1-yl)acetic acid | CHEMBL1290080
TypeSmall organic molecule
Emp. Form.C23H22ClF2NO4S
Mol. Mass.481.94
SMILESC[C@@H](c1ccc(Cl)c(F)c1)n1c2[C@@H](CC(O)=O)CCCc2c2cc(F)cc(c12)S(C)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: