Reaction Details |
| Report a problem with these data |
Target | Zn finger protein |
---|
Ligand | BDBM50332038 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_687568 (CHEMBL1290840) |
---|
Ki | 61.9±n/a nM |
---|
Citation | Maresca, A; Scozzafava, A; Supuran, CT 7,8-disubstituted- but not 6,7-disubstituted coumarins selectively inhibit the transmembrane, tumor-associated carbonic anhydrase isoforms IX and XII over the cytosolic ones I and II in the low nanomolar/subnanomolar range. Bioorg Med Chem Lett20:7255-8 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Zn finger protein |
---|
Name: | Zn finger protein |
Synonyms: | n/a |
Type: | PROTEIN |
Mol. Mass.: | 25827.13 |
Organism: | Nicotiana tabacum |
Description: | ChEMBL_687568 |
Residue: | 234 |
Sequence: | LPLPFFNMDTSHWPQGIGLAKAVEPSKPVPVTERKPRPQKEQAINCPRCNSTNTKFCYYN
NYSLSQPRYFCKTCRRYWTDGGSLRNVPVGGGSRKNKRSNSSSNNSSSSTSSSYKKIPDL
TIPTSSSTQNPKIINEPHDLNLTFNPSTTSNFSNISEFMALPLMNPNSTTSFMSSIMPQI
SDSNNIMYSSSSTGLPNLHDLKPTLNFSLDGFDNNNGYGSLQGETAGAKLFFPL
|
|
|
BDBM50332038 |
---|
n/a |
---|
Name | BDBM50332038 |
Synonyms: | 7-hydroxy-8-acetylcoumarin | 8-Acetyl-7-hydroxy-2H-chromen-2-one | CHEMBL446518 |
Type | Small organic molecule |
Emp. Form. | C11H8O4 |
Mol. Mass. | 204.1788 |
SMILES | CC(=O)c1c(O)ccc2ccc(=O)oc12 |
Structure |
|