Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosyldihydronicotinamide dehydrogenase [quinone]
LigandBDBM22985
Substrate/Competitorn/a
Meas. Tech.ChEMBL_687953
IC50 1500±n/a nM
Citation Nolan KACaraher MCHumphries MPBettley HABryce RAStratford IJ In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett 20:7331-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosyldihydronicotinamide dehydrogenase [quinone]
Name:Ribosyldihydronicotinamide dehydrogenase [quinone]
Synonyms:Metallothionein-3 | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone]
Type:Protein
Mol. Mass.:25917.25
Organism:Homo sapiens (Human)
Description:P16083
Residue:231
Sequence:
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22985
n/a
NameBDBM22985
Synonyms:Aralen | CHEMBL76 | CHLOROQUINE PHOSPHATE | Chlorochin | Chloroquine | Chloroquine, 17 | {4-[(7-chloroquinolin-4-yl)amino]pentyl}diethylamine
TypeAntimalarial
Emp. Form.C18H26ClN3
Mol. Mass.319.872
SMILESCCN(CC)CCCC(C)Nc1ccnc2cc(Cl)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: