Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50332883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_694005
Ki 97.2±n/a nM
Citation Silvestri RLigresti ALa Regina GPiscitelli FGatti VLavecchia ABrizzi APasquini SAllarà MFantini NCarai MABigogno CRozio MGSinisi RNovellino EColombo GDi Marzo VDondio GCorelli F Synthesis and biological evaluation of new N-alkyl 1-aryl-5-(1H-pyrrol-1-yl)-1H-pyrazole-3-carboxamides as cannabinoid receptor ligands. Eur J Med Chem 45:5878-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50332883
n/a
NameBDBM50332883
Synonyms:1-(2,4-Dichlorophenyl)-5-(2,5-dimethyl-1H-pyrrol-1-yl)-Nheptyl-4-methyl-1H-pyrazole-3-carboxamide | CHEMBL1631291
TypeSmall organic molecule
Emp. Form.C24H30Cl2N4O
Mol. Mass.461.427
SMILESCCCCCCCNC(=O)c1nn(c(c1C)-n1c(C)ccc1C)-c1ccc(Cl)cc1Cl |(17.09,-5.48,;16.32,-4.15,;14.78,-4.15,;14,-2.82,;12.46,-2.82,;11.69,-1.49,;10.15,-1.5,;9.37,-.17,;7.83,-.17,;7.06,1.15,;7.05,-1.53,;7.47,-3,;6.19,-3.85,;4.99,-2.89,;5.53,-1.45,;4.7,-.15,;3.56,-3.44,;2.3,-2.54,;2.25,-.99,;1.08,-3.45,;1.55,-4.9,;3.09,-4.9,;3.61,-5.69,;6.19,-5.4,;4.86,-6.17,;4.86,-7.71,;6.19,-8.48,;6.19,-10.02,;7.53,-7.71,;7.53,-6.16,;8.87,-5.38,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: