Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEctonucleotide pyrophosphatase/phosphodiesterase family member 2
LigandBDBM50332915
Substrate/Competitorn/a
Meas. Tech.ChEMBL_694283
Ki 1800±n/a nM
Citation East JEKennedy AJTomsig JLDe Leon ARLynch KRMacdonald TL Synthesis and structure-activity relationships of tyrosine-based inhibitors of autotaxin (ATX). Bioorg Med Chem Lett 20:7132-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Name:Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Synonyms:ATX | Autotaxin | Autotaxin (ATX) | E-NPP 2 | ENPP2 | Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2) | Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 (E-NPP2) | Extracellular lysophospholipase D | LysoPLD | PDNP2
Type:Enzyme
Mol. Mass.:99007.13
Organism:Homo sapiens (Human)
Description:Q13822
Residue:863
Sequence:
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG
RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS
PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL
VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ
PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR
KTSRSYPEILTLKTYLHTYESEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50332915
n/a
NameBDBM50332915
Synonyms:CHEMBL1632612 | CHEMBL1632613 | anti-(3S)-4-(4-(2,4-dimethylbenzyloxy)phenyl)-2-hydroxy-3-palmitamidobutylphosphonic acid
TypeSmall organic molecule
Emp. Form.C35H56NO6P
Mol. Mass.617.796
SMILESCCCCCCCCCCCCCCCC(=O)N[C@@H](Cc1ccc(OCc2ccc(C)cc2C)cc1)C(=O)CP(O)(O)O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: