Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetClass A carbapenemase KPC-2
LigandBDBM50021959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_696792
Ki 11000±n/a nM
Citation Papp-Wallace KMTaracila MHornick JMHujer AMHujer KMDistler AMEndimiani ABonomo RA Substrate selectivity and a novel role in inhibitor discrimination by residue 237 in the KPC-2 beta-lactamase. Antimicrob Agents Chemother 54:2867-77 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Class A carbapenemase KPC-2
Name:Class A carbapenemase KPC-2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31116.99
Organism:Escherichia coli
Description:ChEMBL_696792
Residue:293
Sequence:
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYR
AEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAE
LSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVY
GTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021959
n/a
NameBDBM50021959
Synonyms:CHEMBL777 | MM 14151 | US9120808, Clavulanic acid potassium salt | antibiotic MM 14151 | clavulanic acid
TypeSmall organic molecule
Emp. Form.C8H9NO5
Mol. Mass.199.1608
SMILESOC\C=C1/O[C@@H]2CC(=O)N2[C@H]1C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: