| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Beta-lactamase |
|---|
| Ligand | BDBM50021954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_696792 (CHEMBL1639005) |
|---|
| Ki | 167000±n/a nM |
|---|
| Citation |  Papp-Wallace, KM; Taracila, M; Hornick, JM; Hujer, AM; Hujer, KM; Distler, AM; Endimiani, A; Bonomo, RA Substrate selectivity and a novel role in inhibitor discrimination by residue 237 in the KPC-2 beta-lactamase. Antimicrob Agents Chemother54:2867-77 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Beta-lactamase |
|---|
| Name: | Beta-lactamase |
|---|
| Synonyms: | Class A carbapenemase KPC-2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31116.99 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | ChEMBL_696792 |
|---|
| Residue: | 293 |
|---|
| Sequence: | MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYR
AEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAE
LSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVY
GTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
|
|
|
|---|
| BDBM50021954 |
|---|
| n/a |
|---|
| Name | BDBM50021954 |
|---|
| Synonyms: | (2S,5R)-3,3-Dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | (S)-3,3-Dimethyl-7-(R)-oxo-4,4-dioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | 3,3-Dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | 3,3-Dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid (Sulbactam) | CHEMBL403 | CP-45,899 | SULBACTAM | UNASYN | US20230322715, Compound ALK-09 | US9120808, Sulbactam sodium salt |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H11NO5S |
|---|
| Mol. Mass. | 233.242 |
|---|
| SMILES | CC1(C)[C@@H](N2[C@@H](CC2=O)S1(=O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
