Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase (P70S6K)
LigandBDBM50333483
Substrate/Competitorn/a
Meas. Tech.ChEMBL_698950
IC50 34±n/a nM
Citation Ye PKuhn CJuan MSharma RConnolly BAlton GLiu HStanton RKablaoui NM Potent and selective thiophene urea-templated inhibitors of S6K. Bioorg Med Chem Lett 21:849-52 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase (P70S6K)
Name:Ribosomal protein S6 kinase (P70S6K)
Synonyms:70 kDa ribosomal protein S6 kinase 1 | 70 kDa ribosomal protein S6 kinase 1 (P70s6k) | 70 kDa ribosomal protein kinase (p70S6K) | Protein kinase 70S6K (T412E) | Ribosomal protein S6 kinase I | S6K1 | p70 S6 ribosomal protein kinase 1 | p70S6K1
Type:Enzyme
Mol. Mass.:59139.89
Organism:Homo sapiens (Human)
Description:His-tagged S6K1.
Residue:525
Sequence:
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50333483
n/a
NameBDBM50333483
Synonyms:1-[5-tert-Butyl-3-(1,1-dioxo-1lambda*6*-thiomorpholine-4-carbonyl)-thiophen-2-yl]-3-(1H-indazol-5-yl)-urea | CHEMBL1641789
TypeSmall organic molecule
Emp. Form.C21H25N5O4S2
Mol. Mass.475.584
SMILESCC(C)(C)c1cc(C(=O)N2CCS(=O)(=O)CC2)c(NC(=O)Nc2ccc3[nH]ncc3c2)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: