| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50161746 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_699802 (CHEMBL1645648) |
|---|
| Ki | 6140±n/a nM |
|---|
| Citation |  Gallant, M; Beaulieu, C; Berthelette, C; Colucci, J; Crackower, MA; Dalton, C; Denis, D; Ducharme, Y; Friesen, RW; Guay, D; Gervais, FG; Hamel, M; Houle, R; Krawczyk, CM; Kosjek, B; Lau, S; Leblanc, Y; Lee, EE; Levesque, JF; Mellon, C; Molinaro, C; Mullet, W; O'Neill, GP; O'Shea, P; Sawyer, N; Sillaots, S; Simard, D; Slipetz, D; Stocco, R; Sørensen, D; Truong, VL; Wong, E; Wu, J; Zaghdane, H; Wang, Z Discovery of MK-7246, a selective CRTH2 antagonist for the treatment of respiratory diseases. Bioorg Med Chem Lett21:288-93 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50161746 |
|---|
| n/a |
|---|
| Name | BDBM50161746 |
|---|
| Synonyms: | (R)-3-(3-(4-fluorophenylsulfonamido)-1,2,3,4-tetrahydrocarbazol-9-yl)propanoic acid | 3-[(R)-3-(4-Fluoro-benzenesulfonylamino)-1,2,3,4-tetrahydro-carbazol-9-yl]-propionic acid | CHEMBL361812 | RAMATROBAN |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21FN2O4S |
|---|
| Mol. Mass. | 416.466 |
|---|
| SMILES | OC(=O)CCn1c2CC[C@H](Cc2c2ccccc12)NS(=O)(=O)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
