Reaction Details |
| Report a problem with these data |
Target | Thromboxane A2 receptor |
---|
Ligand | BDBM50333846 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_699803 (CHEMBL1645649) |
---|
Ki | 11±n/a nM |
---|
Citation | Gallant, M; Beaulieu, C; Berthelette, C; Colucci, J; Crackower, MA; Dalton, C; Denis, D; Ducharme, Y; Friesen, RW; Guay, D; Gervais, FG; Hamel, M; Houle, R; Krawczyk, CM; Kosjek, B; Lau, S; Leblanc, Y; Lee, EE; Levesque, JF; Mellon, C; Molinaro, C; Mullet, W; O'Neill, GP; O'Shea, P; Sawyer, N; Sillaots, S; Simard, D; Slipetz, D; Stocco, R; Sørensen, D; Truong, VL; Wong, E; Wu, J; Zaghdane, H; Wang, Z Discovery of MK-7246, a selective CRTH2 antagonist for the treatment of respiratory diseases. Bioorg Med Chem Lett21:288-93 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Thromboxane A2 receptor |
---|
Name: | Thromboxane A2 receptor |
Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
Type: | Enyzme |
Mol. Mass.: | 37445.28 |
Organism: | Homo sapiens (Human) |
Description: | P21731 |
Residue: | 343 |
Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
BDBM50333846 |
---|
n/a |
---|
Name | BDBM50333846 |
Synonyms: | (R)-2-(7-(4-fluorophenylsulfonamido)-6,7,8,9-tetrahydropyrido[1,2-a]indol-10-yl)acetic acid | CHEMBL1643785 |
Type | Small organic molecule |
Emp. Form. | C20H19FN2O4S |
Mol. Mass. | 402.439 |
SMILES | OC(=O)Cc1c2CC[C@H](Cn2c2ccccc12)NS(=O)(=O)c1ccc(F)cc1 |r| |
Structure |
|