Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThioredoxin reductase 2, mitochondrial
LigandBDBM50005886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_700049
IC50 132000±n/a nM
Citation Sorrentino FKarioti AGratteri PRigobello MPScutari GMessori LBindoli AChioccioli MGabbiani CBergonzi MCBilia AR Hypericins and thioredoxin reductase: Biochemical and docking studies disclose the molecular basis for effective inhibition by naphthodianthrones. Bioorg Med Chem 19:631-41 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thioredoxin reductase 2, mitochondrial
Name:Thioredoxin reductase 2, mitochondrial
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:56441.28
Organism:Rattus norvegicus
Description:ChEMBL_700049
Residue:525
Sequence:
MAAIVAALRGSSGRFRPQTRVLTRGTRGAAGAASAAGGQQNFDLLVIGGGSGGLACAKEA
AQLGRKVAVADYVEPSPRGTKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAQHYGWEVA
QPVQHNWKAMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVNEHTVHGVDKAGKVTQ
LSAKHIVIATGGRPKYPTQVKGALEHGITSDDIFWLKESPGKTLVVGASYVALECAGFLT
GIGLDTTVMMRSVPLRGFDQQMASLVTEHMESHGTRFLKGCVPSLIRKLPTNQLQVTWED
LASGKEDVGTFDTVLWAIGRVPETRNLNLEKAGVNTNPKNQKIIVDAQEATSVPHIYAIG
DVAEGRPELTPTAIKAGKLLAQRLFGKSSTLMNYSNVPTTVFTPLEYGCVGLSEEEAVAL
HGQEHIEVYHAYYKPLEFTVADRDASQCYIKMVCMREPPQLVLGLHFLGPNAGEVTQGFA
LGIQCGASYAQVMQTVGIHPTCSEEVVKLHISKRSGLDPTVTGCG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005886
n/a
NameBDBM50005886
Synonyms:1,8-Dihydroxy-3-methoxy-6-methylanthraquinone | 1,8-dihydroxy-3-methoxy-6-methylanthracene-9,10-dione | CHEMBL42624 | Physcione | physcion
TypeSmall organic molecule
Emp. Form.C16H12O5
Mol. Mass.284.2635
SMILESCOc1cc(O)c2C(=O)c3c(O)cc(C)cc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: