Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP4 subtype
LigandBDBM50334136
Substrate/Competitorn/a
Meas. Tech.ChEMBL_698178
Ki 0.28±n/a nM
Citation Boyd MJBerthelette CChiasson JFClark PColucci JDenis DHan YLévesque JFMathieu MCStocco RTherien ARowland SWrona MXu D A novel series of potent and selective EP(4) receptor ligands: facile modulation of agonism and antagonism. Bioorg Med Chem Lett 21:484-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP4 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50334136
n/a
NameBDBM50334136
Synonyms:(S)-4-(1-(1-(biphenyl-4-ylmethyl)indoline-7-carboxamido)ethyl)benzoic acid | CHEMBL1645141
TypeSmall organic molecule
Emp. Form.C31H28N2O3
Mol. Mass.476.5656
SMILESC[C@H](NC(=O)c1cccc2CCN(Cc3ccc(cc3)-c3ccccc3)c12)c1ccc(cc1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: