| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50335451 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_701955 (CHEMBL1657527) |
|---|
| EC50 | 580±n/a nM |
|---|
| Citation |  Saha, AK; Yu, X; Lin, J; Lobera, M; Sharadendu, A; Chereku, S; Schutz, N; Segal, D; Marantz, Y; McCauley, D; Middleton, S; Siu, J; Börli, RW; Buys, J; Horner, M; Salyers, K; Schrag, M; Vargas, HM; Xu, Y; McElvain, M Benzofuran Derivatives as Potent, Orally Active S1P1 Receptor Agonists: A Preclinical Lead Molecule for MS ACS Med Chem Lett2:97-101 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50335451 |
|---|
| n/a |
|---|
| Name | BDBM50335451 |
|---|
| Synonyms: | 1-(4-(5-phenethylbenzofuran-2-yl)benzyl)azetidine-3-carboxylic acid | CHEMBL1651705 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H25NO3 |
|---|
| Mol. Mass. | 411.4923 |
|---|
| SMILES | OC(=O)C1CN(Cc2ccc(cc2)-c2cc3cc(CCc4ccccc4)ccc3o2)C1 |
|---|
| Structure | 
|
|---|
Search and Browse
