Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A3
LigandBDBM50335694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_715074
Ki 3±n/a nM
Citation Yaziji VRodríguez DGutiérrez-de-Terán HCoelho ACaamaño OGarcía-Mera XBrea JLoza MICadavid MISotelo E Pyrimidine derivatives as potent and selective A3 adenosine receptor antagonists. J Med Chem 54:457-71 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A3
Name:Adenosine receptor
Synonyms:A3 adenosine receptor (hA3) | Adenosine A3 receptor (A3AR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36197.32
Organism:Homo sapiens (Human)
Description:P0DMS8
Residue:318
Sequence:
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335694
n/a
NameBDBM50335694
Synonyms:CHEMBL1650384 | N-2,6-difuran-2-yl)pyrimidin-4-yl)acetamide
TypeSmall organic molecule
Emp. Form.C14H11N3O3
Mol. Mass.269.2554
SMILESCC(=O)Nc1cc(nc(n1)-c1ccco1)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: