| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lactoylglutathione lyase |
|---|
| Ligand | BDBM17638 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_716549 (CHEMBL1670273) |
|---|
| Ki | 18100±n/a nM |
|---|
| Citation |  Yuan, M; Luo, M; Song, Y; Xu, Q; Wang, X; Cao, Y; Bu, X; Ren, Y; Hu, X Identification of curcumin derivatives as human glyoxalase I inhibitors: A combination of biological evaluation, molecular docking, 3D-QSAR and molecular dynamics simulation studies. Bioorg Med Chem19:1189-96 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lactoylglutathione lyase |
|---|
| Name: | Lactoylglutathione lyase |
|---|
| Synonyms: | Aldoketomutase | GLO1 | Glx I | Glyoxalase 1 (GLO1) | Glyoxalase I | Ketone-aldehyde mutase | LGUL_HUMAN | Methylglyoxalase | S-D-lactoylglutathione methylglyoxal lyase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 20772.95 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q04760 |
|---|
| Residue: | 184 |
|---|
| Sequence: | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
|
|
|
|---|
| BDBM17638 |
|---|
| n/a |
|---|
| Name | BDBM17638 |
|---|
| Synonyms: | 2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US11478464, Compound Indomethacin | US11786535, Compound Indomethacin | US9271961, Indomethacin | indometacin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16ClNO4 |
|---|
| Mol. Mass. | 357.788 |
|---|
| SMILES | COc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
