Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlyoxalase 1 (GLO1)
LigandBDBM17638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_716549
Ki 18100±n/a nM
Citation Yuan MLuo MSong YXu QWang XCao YBu XRen YHu X Identification of curcumin derivatives as human glyoxalase I inhibitors: A combination of biological evaluation, molecular docking, 3D-QSAR and molecular dynamics simulation studies. Bioorg Med Chem 19:1189-96 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glyoxalase 1 (GLO1)
Name:Glyoxalase I
Synonyms:Aldoketomutase | Glx I | Glyoxalase I | Ketone-aldehyde mutase | Methylglyoxalase | S-D-lactoylglutathione methylglyoxal lyase
Type:Enzyme
Mol. Mass.:20772.95
Organism:Homo sapiens (Human)
Description:Q04760
Residue:184
Sequence:
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17638
n/a
NameBDBM17638
Synonyms:2-{1-[(4-chlorophenyl)carbonyl]-5-methoxy-2-methyl-1H-indol-3-yl}acetic acid | CHEMBL6 | Indocin | Indomethacin | US9271961, Indomethacin | indometacin
TypeSmall organic molecule
Emp. Form.C19H16ClNO4
Mol. Mass.357.788
SMILESCOc1ccc2n(C(=O)c3ccc(Cl)cc3)c(C)c(CC(O)=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: