Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin V
LigandBDBM50336482
Substrate/Competitorn/a
Meas. Tech.ChEMBL_716901
Ki 200±n/a nM
Citation Severino RPGuido RVMarques EFBrömme Dda Silva MFFernandes JBAndricopulo ADVieira PC Acridone alkaloids as potent inhibitors of cathepsin V. Bioorg Med Chem 19:1477-81 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin V
Name:Cathepsin V
Synonyms:Cathepsin (V and K) | Cathepsin U
Type:Enzyme
Mol. Mass.:37341.06
Organism:Homo sapiens (Human)
Description:O60911
Residue:334
Sequence:
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIE
LHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDW
RKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNG
GFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAV
ATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK
NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336482
n/a
NameBDBM50336482
Synonyms:CHEMBL1668599 | citibrasine
TypeSmall organic molecule
Emp. Form.C17H17NO6
Mol. Mass.331.32
SMILESCOc1c(OC)c(OC)c2n(C)c3c(O)cccc3c(=O)c2c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: