Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM18069 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_723694 (CHEMBL1677364) |
---|
Ki | 4.4±n/a nM |
---|
Citation | Bourne, CR; Barrow, EW; Bunce, RA; Bourne, PC; Berlin, KD; Barrow, WW Inhibition of antibiotic-resistant Staphylococcus aureus by the broad-spectrum dihydrofolate reductase inhibitor RAB1. Antimicrob Agents Chemother54:3825-33 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
Type: | Enzyme |
Mol. Mass.: | 18249.71 |
Organism: | Staphylococcus aureus |
Description: | n/a |
Residue: | 159 |
Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
BDBM18069 |
---|
n/a |
---|
Name | BDBM18069 |
Synonyms: | 5-[(3,4,5-trimethoxyphenyl)methyl]pyrimidine-2,4-diamine | CHEMBL22 | TMP | Trimethoprim | Trimethoprim (TMP) | US10870625, Compound TMP |
Type | Small organic molecule |
Emp. Form. | C14H18N4O3 |
Mol. Mass. | 290.3177 |
SMILES | COc1cc(Cc2cnc(N)nc2N)cc(OC)c1OC |
Structure |
|