Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50336601 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_725804 (CHEMBL1678400) |
---|
EC50 | 0.690000±n/a nM |
---|
Citation | Spetea, M; Windisch, P; Guo, Y; Bileviciute-Ljungar, I; Schütz, J; Asim, MF; Berzetei-Gurske, IP; Riba, P; Kiraly, K; Fürst, S; Al-Khrasani, M; Schmidhammer, H Synthesis and pharmacological activities of 6-glycine substituted 14-phenylpropoxymorphinans, a novel class of opioids with high opioid receptor affinities and antinociceptive potencies. J Med Chem54:980-8 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50336601 |
---|
n/a |
---|
Name | BDBM50336601 |
Synonyms: | CHEMBL3216476 | [[17-Cyclopropylmethyl-4,5alpha-epoxy-3-hydroxy-14beta-[(3-phenylpropyl)oxy]morphinan-6beta-yl]amino]acetic Acid Dihydrochloride |
Type | Small organic molecule |
Emp. Form. | C31H40Cl2N2O5 |
Mol. Mass. | 591.566 |
SMILES | Cl.Cl.[H][C@@]12Oc3c4c(C[C@@]5([H])N(CC6CC6)CC[C@@]14[C@]5(CC[C@@H]2NCC(O)=O)OCCCc1ccccc1)ccc3O |r,TLB:12:11:19:6.7.8| |
Structure |
|