| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 3 |
|---|
| Ligand | BDBM50336954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_718611 (CHEMBL1680637) |
|---|
| EC50 | 687±n/a nM |
|---|
| Citation |  Lanman, BA; Cee, VJ; Cheruku, SR; Frohn, M; Golden, J; Lin, J; Lobera, M; Marantz, Y; Muller, KM; Neira, SC; Pickrell, AJ; Rivenzon-Segal, D; Schutz, N; Sharadendu, A; Yu, X; Zhang, Z; Buys, J; Fiorino, M; Gore, A; Horner, M; Itano, A; McElvain, M; Middleton, S; Schrag, M; Vargas, HM; Xu, H; Xu, Y; Zhang, X; Siu, J Discovery of a Potent, S1P3-Sparing Benzothiazole Agonist of Sphingosine-1-Phosphate Receptor 1 (S1P1) ACS Med Chem Lett2:102-106 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 3 |
|---|
| Name: | Sphingosine 1-phosphate receptor 3 |
|---|
| Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42278.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99500 |
|---|
| Residue: | 378 |
|---|
| Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
|---|
| BDBM50336954 |
|---|
| n/a |
|---|
| Name | BDBM50336954 |
|---|
| Synonyms: | 1-((4-(5-(3-Fluorobenzyl)benzo[d]thiazol-2-yl)-3-fluorophenyl)methyl)azetidine-3-carboxylic acid | CHEMBL1672559 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H20F2N2O2S |
|---|
| Mol. Mass. | 450.5 |
|---|
| SMILES | OC(=O)C1CN(Cc2ccc(-c3nc4cc(Cc5cccc(F)c5)ccc4s3)c(F)c2)C1 |
|---|
| Structure | 
|
|---|
Search and Browse
