Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50336996
Substrate/Competitorn/a
Meas. Tech.ChEMBL_719009
Ki 0.600000±n/a nM
Citation Eastwood PEsteve CGonzález JFonquerna SAiguadé JCarranco IsDoménech TAparici MsMiralpeix MAlbertí JCórdoba MFernández RPont MsGodessart NsPrats NLoza MsCadavid MsNueda A Discovery of LAS101057: A Potent, Selective, and Orally Efficacious A2B Adenosine Receptor Antagonist ACS Med Chem Lett 2:213-218 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptor
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336996
n/a
NameBDBM50336996
Synonyms:CHEMBL1672631 | N-[6-(2-Fluorophenyl)-5-(3-fluoropyridin-4-yl)pyrazin-2-yl]cyclopropane-carboxamide
TypeSmall organic molecule
Emp. Form.C19H14F2N4O
Mol. Mass.352.3375
SMILESFc1ccccc1-c1nc(NC(=O)C2CC2)cnc1-c1ccncc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: