Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-2 adrenergic receptor
LigandBDBM50318159
Substrate/Competitorn/a
Meas. Tech.ChEMBL_726482
EC50 1±n/a nM
Citation Pérez DCrespo MSolé LPrat MCarcasona CCalama EOtal RGavaldá AGómez-Angelats MMiralpeix MPuig C Discovery of substituted phenyl urea derivatives as novel long-actingß2-adrenoreceptor agonists. Bioorg Med Chem Lett 21:1545-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-2 adrenergic receptor
Name:Beta-2 adrenergic receptor
Synonyms:adrenergic Beta2
Type:Enzyme Catalytic Domain
Mol. Mass.:46993.24
Organism:GUINEA PIG
Description:adrenergic Beta2 ADRB2 GUINEA PIG::Q8K4Z4
Residue:418
Sequence:
MGHLGNGSDFLLAPNASHAPDHNVTRERDEAWVVGMAIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMNMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWVVSGLTSFLPIQMHWYRATHKD
AINCYAEETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKKQLQKIDRSEGRF
HTQNLSQVEQDGRSGHGLRRSSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSALKAYGNDCSSNSNG
KTDYTGEPNVCHQGQEKERELLCEDPPGTEDLVSCPGTVPSDSIDSQGRNYSTNDSLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50318159
n/a
NameBDBM50318159
Synonyms:8-Hydroxy-5-[(R)-1-hydroxy-2-(5,6-diethylindan-2-ylamino)-ethyl]-1H-quinolin-2-one | CHEMBL1095777 | INDACATEROL
TypeSmall organic molecule
Emp. Form.C24H28N2O3
Mol. Mass.392.4907
SMILESCCc1cc2CC(Cc2cc1CC)NC[C@H](O)c1ccc(O)c2[nH]c(=O)ccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: