Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-1 (MMP1)
LigandBDBM50337727
Substrate/Competitorn/a
Meas. Tech.ChEMBL_728835
IC50>10000±n/a nM
Citation De Savi CPape ACumming JGTing ASmith PDBurrows JNMills MDavies CLamont SMilne DCook CMoore PSawyer YGerhardt S The design and synthesis of novel N-hydroxyformamide inhibitors of ADAM-TS4 for the treatment of osteoarthritis. Bioorg Med Chem Lett 21:1376-81 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-1 (MMP1)
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Fibroblast collagenase | Interstitial collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50337727
n/a
NameBDBM50337727
Synonyms:CHEMBL1683457 | N-((2S,4S)-1-(4-(2,5-dimethylphenethyl)piperidin-1-ylsulfonyl)-4-(5-fluoropyrimidin-2-yl)-2-methylpentan-2-yl)-N-hydroxyformamide
TypeSmall organic molecule
Emp. Form.C26H37FN4O4S
Mol. Mass.520.66
SMILESC[C@@H](C[C@@](C)(CS(=O)(=O)N1CCC(CCc2cc(C)ccc2C)CC1)N(O)C=O)c1ncc(F)cn1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: