Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VB
LigandBDBM50337754
Substrate/Competitorn/a
Meas. Tech.ChEMBL_726764
Ki 7.8±n/a nM
Citation Maresca ASupuran CT (R)-/(S)-10-camphorsulfonyl-substituted aromatic/heterocyclic sulfonamides selectively inhibit mitochondrial over cytosolic carbonic anhydrases. Bioorg Med Chem Lett 21:1334-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase VB
Name:Carbonic Anhydrase VB
Synonyms:CA-VB | Carbonate dehydratase VB | Carbonic anhydrase 5B (CA VB) | Carbonic anhydrase 5B, mitochondrial | Carbonic anhydrase 5B, mitochondrial precursor | Carbonic anhydrase VB (CA VB)
Type:Enzyme
Mol. Mass.:36440.83
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:317
Sequence:
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50337754
n/a
NameBDBM50337754
Synonyms:(Z)-5-(((1R)-7,7-Dimethyl-2-oxobicyclo[2.2.1]heptan-1-yl)methylsulfonylimino)-4-methyl-4,5-dihydro-1,3,4-thiadiazole-2-sulfonamide | CHEMBL1683474
TypeSmall organic molecule
Emp. Form.C13H20N4O5S3
Mol. Mass.408.517
SMILESCn1nc(sc1=NS(=O)(=O)C[C@@]12CCC(CC1=O)C2(C)C)S(N)(=O)=O |r,w:6.7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: